Lineage for d1dqdh1 (1dqd H:1-122)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288513Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 1288537Domain d1dqdh1: 1dqd H:1-122 [20441]
    Other proteins in same PDB: d1dqdh2, d1dqdl1, d1dqdl2
    part of Fab HGR-2 F6, a competitive antagonist of the glucagon receptor

Details for d1dqdh1

PDB Entry: 1dqd (more details), 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
PDB Compounds: (H:) fab hgr-2 f6

SCOPe Domain Sequences for d1dqdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqdh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
ss

SCOPe Domain Coordinates for d1dqdh1:

Click to download the PDB-style file with coordinates for d1dqdh1.
(The format of our PDB-style files is described here.)

Timeline for d1dqdh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqdh2