SCOP 1.73: Domain d1dqdh1: 1dqd H:1-122

Lineage for d1dqdh1 (1dqd H:1-122)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (22 PDB entries)

8. Domain d1dqdh1: 1dqd H:1-122 [20441]
   Other proteins in same PDB: d1dqdh2, d1dqdl1, d1dqdl2
   part of Fab HGR-2 F6, a competitive antagonist of the glucagon receptor

Details for d1dqdh1

PDB Entry: 1dqd, 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

PDB Compounds: (H:) fab hgr-2 f6

SCOP Domain Sequences for d1dqdh1:

Sequence; same for both SEQRES and ATOM records:

>d1dqdh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
ss

Timeline for d1dqdh1:

• d1dqdh1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqdh1 appears in SCOP 1.71
  
• d1dqdh1 appears in SCOP 1.75
  
• d1dqdh1 appears in the current release, SCOPe 2.08