Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
Protein automated matches [226885] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225066] (5 PDB entries) |
Domain d2gl6d2: 2gl6 D:138-415 [204402] Other proteins in same PDB: d2gl6a1, d2gl6b1, d2gl6c1, d2gl6d1, d2gl6e1, d2gl6f1, d2gl6g1, d2gl6h1 automated match to d1crka2 complexed with adp, mg, unx |
PDB Entry: 2gl6 (more details), 2.3 Å
SCOPe Domain Sequences for d2gl6d2:
Sequence, based on SEQRES records: (download)
>d2gl6d2 d.128.1.2 (D:138-415) automated matches {Human (Homo sapiens) [TaxId: 9606]} vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig rsevelvqividgvnylvdcekklergqdikvppplpq
>d2gl6d2 d.128.1.2 (D:138-415) automated matches {Human (Homo sapiens) [TaxId: 9606]} vmkhttdldaskitqgqfdehyvlssrvrtgrsirglslppactraerrevenvaitale glkgdlagryyklsemteqdqqrliddhflfdkpvsplltcagmardwpdargiwhnydk tfliwineedhtrvismekggnmkrvferfcrglkeverliqergwefmwnerlgyiltc psnlgtglragvhvripklskdprfskilenlrlqkrgtggvdtaavadvydisnidrig rsevelvqividgvnylvdcekklkvppplpq
Timeline for d2gl6d2: