Lineage for d2gkib2 (2gki B:159-274)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767056Domain d2gkib2: 2gki B:159-274 [204394]
    automated match to d1nqba2

Details for d2gkib2

PDB Entry: 2gki (more details), 2.88 Å

PDB Description: heavy and light chain variable single domains of an anti-dna binding antibody hydrolyze both double- and single-stranded dnas without sequence specificity
PDB Compounds: (B:) Nuclease

SCOPe Domain Sequences for d2gkib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkib2 b.1.1.0 (B:159-274) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleikhhh

SCOPe Domain Coordinates for d2gkib2:

Click to download the PDB-style file with coordinates for d2gkib2.
(The format of our PDB-style files is described here.)

Timeline for d2gkib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gkib1