Lineage for d2gkia2 (2gki A:159-271)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2371202Domain d2gkia2: 2gki A:159-271 [204392]
    Other proteins in same PDB: d2gkia3, d2gkib3
    automated match to d1nqba2

Details for d2gkia2

PDB Entry: 2gki (more details), 2.88 Å

PDB Description: heavy and light chain variable single domains of an anti-dna binding antibody hydrolyze both double- and single-stranded dnas without sequence specificity
PDB Compounds: (A:) Nuclease

SCOPe Domain Sequences for d2gkia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkia2 b.1.1.0 (A:159-271) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik

SCOPe Domain Coordinates for d2gkia2:

Click to download the PDB-style file with coordinates for d2gkia2.
(The format of our PDB-style files is described here.)

Timeline for d2gkia2: