SCOPe 2.04: Domain d2gkia1: 2gki A:23-132

Lineage for d2gkia1 (2gki A:23-132)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2gkia1: 2gki A:23-132 [204391]
   automated match to d1nqba1

Details for d2gkia1

PDB Entry: 2gki, 2.88 Å

PDB Description: heavy and light chain variable single domains of an anti-dna binding antibody hydrolyze both double- and single-stranded dnas without sequence specificity

PDB Compounds: (A:) Nuclease

SCOPe Domain Sequences for d2gkia1:

Sequence; same for both SEQRES and ATOM records:

>d2gkia1 b.1.1.0 (A:23-132) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycargaykrgyamdyw

Timeline for d2gkia1:

• d2gkia1 first appeared in SCOPe 2.03
  
• d2gkia1 appears in SCOPe 2.05
  
• d2gkia1 appears in the current release, SCOPe 2.08