SCOP 1.71: Domain d32c2b1: 32c2 B:1-119

Lineage for d32c2b1 (32c2 B:1-119)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)

8. Domain d32c2b1: 32c2 B:1-119 [20439]
   Other proteins in same PDB: d32c2a1, d32c2a2, d32c2b2
   part of the cytochrome P450-arom activity suppressing Fab 32C2

Details for d32c2b1

PDB Entry: 32c2, 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase

SCOP Domain Sequences for d32c2b1:

Sequence; same for both SEQRES and ATOM records:

>d32c2b1 b.1.1.1 (B:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
dvqlqesgpglvkpsqslsltctvtgysissdyawnwirqfpgnklewmgyisysgstsy
npslksrisitrdtsknqfflqlssvttedtatyycargyygsshspvwgagttvtvss

Timeline for d32c2b1:

• d32c2b1 first appeared (with stable ids) in SCOP 1.55
  
• d32c2b1 appears in SCOP 1.69
  
• d32c2b1 appears in SCOP 1.73
  
• d32c2b1 appears in the current release, SCOPe 2.08