SCOPe 2.08: Domain d2gk0a1: 2gk0 A:1-108

Lineage for d2gk0a1 (2gk0 A:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2gk0a1: 2gk0 A:1-108 [204386]
   Other proteins in same PDB: d2gk0a2, d2gk0l2
   automated match to d2jell1

Details for d2gk0a1

PDB Entry: 2gk0, 2.45 Å

PDB Description: Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2

PDB Compounds: (A:) Catalytic elimination antibody 13G5 light chain

SCOPe Domain Sequences for d2gk0a1:

Sequence; same for both SEQRES and ATOM records:

>d2gk0a1 b.1.1.1 (A:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleikr

Timeline for d2gk0a1:

• d2gk0a1 first appeared in SCOPe 2.03
  
• d2gk0a1 appears in SCOPe 2.07