SCOPe 2.03: Domain d2gjzl2: 2gjz L:109-212

Lineage for d2gjzl2 (2gjz L:109-212)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d2gjzl2: 2gjz L:109-212 [204385]
   Other proteins in same PDB: d2gjza1, d2gjzl1
   automated match to d2jell2
   complexed with zn

Details for d2gjzl2

PDB Entry: 2gjz, 2.65 Å

PDB Description: Structure of Catalytic Elimination Antibody 13G5 from a crystal in space group P2(1)

PDB Compounds: (L:) Catalytic elimination antibody 13G5 light chain

SCOPe Domain Sequences for d2gjzl2:

Sequence; same for both SEQRES and ATOM records:

>d2gjzl2 b.1.1.0 (L:109-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2gjzl2:

• d2gjzl2 is new in SCOPe 2.03-stable
  
• d2gjzl2 appears in SCOPe 2.04
  
• d2gjzl2 appears in the current release, SCOPe 2.08