SCOPe 2.05: Domain d2gjjb1: 2gjj B:-1-113

Lineage for d2gjjb1 (2gjj B:-1-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d2gjjb1: 2gjj B:-1-113 [204380]
   automated match to d1nqba2
   complexed with gol

Details for d2gjjb1

PDB Entry: 2gjj, 2.1 Å

PDB Description: crystal structure of a single chain antibody sca21 against her2/erbb2

PDB Compounds: (B:) A21 single-chain antibody fragment against erbB2

SCOPe Domain Sequences for d2gjjb1:

Sequence; same for both SEQRES and ATOM records:

>d2gjjb1 b.1.1.0 (B:-1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswaf
trksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleik

Timeline for d2gjjb1:

• d2gjjb1 first appeared in SCOPe 2.03
  
• d2gjjb1 appears in SCOPe 2.04
  
• d2gjjb1 appears in SCOPe 2.06
  
• d2gjjb1 appears in the current release, SCOPe 2.08