Lineage for d32c2a1 (32c2 A:1-110)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653386Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 653420Domain d32c2a1: 32c2 A:1-110 [20438]
    Other proteins in same PDB: d32c2a2, d32c2b1, d32c2b2
    part of the cytochrome P450-arom activity suppressing Fab 32C2

Details for d32c2a1

PDB Entry: 32c2 (more details), 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase
PDB Compounds: (A:) igg1 antibody 32c2

SCOP Domain Sequences for d32c2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d32c2a1 b.1.1.1 (A:1-110) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratiscrasksvstsgygymhwnqqkpgqpprlliylvsnles
gvparfsgsgsgtdftlnihpveeedaatyycqhirepltfgggtkleik

SCOP Domain Coordinates for d32c2a1:

Click to download the PDB-style file with coordinates for d32c2a1.
(The format of our PDB-style files is described here.)

Timeline for d32c2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d32c2a2