Class g: Small proteins [56992] (92 folds) |
Fold g.19: Crisp domain-like [57545] (1 superfamily) disulfide-rich all-alpha fold |
Superfamily g.19.1: Crisp domain-like [57546] (3 families) |
Family g.19.1.0: automated matches [227153] (1 protein) not a true family |
Protein automated matches [226858] (4 species) not a true protein |
Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries) |
Domain d2gizb2: 2giz B:165-221 [204377] Other proteins in same PDB: d2giza1, d2gizb1 automated match to d1rc9a2 |
PDB Entry: 2giz (more details), 1.68 Å
SCOPe Domain Sequences for d2gizb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gizb2 g.19.1.0 (B:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii
Timeline for d2gizb2: