Lineage for d2gizb1 (2giz B:6-164)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211337Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2211338Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2211339Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2211352Protein automated matches [194852] (3 species)
    not a true protein
  7. 2211353Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)
  8. 2211357Domain d2gizb1: 2giz B:6-164 [204376]
    Other proteins in same PDB: d2giza2, d2gizb2
    automated match to d1rc9a1

Details for d2gizb1

PDB Entry: 2giz (more details), 1.68 Å

PDB Description: Structural and functional analysis of Natrin, a member of crisp-3 family blocks a variety of ion channels
PDB Compounds: (B:) Natrin-1

SCOPe Domain Sequences for d2gizb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gizb1 d.111.1.1 (B:6-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl
rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty
ragcavsycpssawsyfyvcqycpsgnfqgktatpyklg

SCOPe Domain Coordinates for d2gizb1:

Click to download the PDB-style file with coordinates for d2gizb1.
(The format of our PDB-style files is described here.)

Timeline for d2gizb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gizb2