SCOPe 2.08: Domain d2giza2: 2giz A:165-221

Lineage for d2giza2 (2giz A:165-221)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (5 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries)

8. Domain d2giza2: 2giz A:165-221 [204375]
   Other proteins in same PDB: d2giza1, d2gizb1
   automated match to d1rc9a2

Details for d2giza2

PDB Entry: 2giz, 1.68 Å

PDB Description: Structural and functional analysis of Natrin, a member of crisp-3 family blocks a variety of ion channels

PDB Compounds: (A:) Natrin-1

SCOPe Domain Sequences for d2giza2:

Sequence; same for both SEQRES and ATOM records:

>d2giza2 g.19.1.0 (A:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii

Timeline for d2giza2:

• d2giza2 first appeared in SCOPe 2.03
  
• d2giza2 appears in SCOPe 2.07