SCOPe 2.05: Domain d1qfwi_: 1qfw I:

Lineage for d1qfwi_ (1qfw I:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1qfwi_: 1qfw I: [20437]
   Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwl_, d1qfwm_
   part of anti-[gonadotropin beta subunit] Fv
   complexed with nag

Details for d1qfwi_

PDB Entry: 1qfw, 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

PDB Compounds: (I:) antibody (anti beta subunit) (heavy chain)

SCOPe Domain Sequences for d1qfwi_:

Sequence; same for both SEQRES and ATOM records:

>d1qfwi_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
s

Timeline for d1qfwi_:

• d1qfwi_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfwi_ appears in SCOPe 2.04
  
• d1qfwi_ appears in SCOPe 2.06
  
• d1qfwi_ appears in the current release, SCOPe 2.08, called d1qfwi1