Lineage for d1qfwi_ (1qfw I:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7184Species Anti-[gonadotropin beta subunit] Fv, kappa L chain [48893] (1 PDB entry)
  8. 7185Domain d1qfwi_: 1qfw I: [20437]
    Other proteins in same PDB: d1qfwa_, d1qfwb_

Details for d1qfwi_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwi_ b.1.1.1 (I:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin beta subunit] Fv, kappa L chain}
qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
s

SCOP Domain Coordinates for d1qfwi_:

Click to download the PDB-style file with coordinates for d1qfwi_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwi_: