![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Anti-[gonadotropin beta subunit] Fv, kappa L chain [48893] (1 PDB entry) |
![]() | Domain d1qfwi_: 1qfw I: [20437] Other proteins in same PDB: d1qfwa_, d1qfwb_ |
PDB Entry: 1qfw (more details), 3.5 Å
SCOP Domain Sequences for d1qfwi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfwi_ b.1.1.1 (I:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin beta subunit] Fv, kappa L chain} qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv s
Timeline for d1qfwi_: