Lineage for d1qfwm_ (1qfw M:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653731Domain d1qfwm_: 1qfw M: [20436]
    Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwh_, d1qfwi_
    part of anti-[gonadotropin beta subunit] Fv
    complexed with nag

Details for d1qfwm_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
PDB Compounds: (M:) antibody (anti beta subunit) (light chain)

SCOP Domain Sequences for d1qfwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwm_ b.1.1.1 (M:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqspksmsmsvgervtlsckasetvdsfvswyqqkpeqspkllifgasnrfsgvpd
rftgsgsatdftltissvqaedfadyhcgqtynhpytfgggtkleikr

SCOP Domain Coordinates for d1qfwm_:

Click to download the PDB-style file with coordinates for d1qfwm_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwm_: