SCOP 1.71: Domain d1qfwm_: 1qfw M:

Lineage for d1qfwm_ (1qfw M:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1qfwm_: 1qfw M: [20436]
   Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwh_, d1qfwi_
   part of anti-[gonadotropin beta subunit] Fv
   complexed with nag

Details for d1qfwm_

PDB Entry: 1qfw, 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwm_:

Sequence; same for both SEQRES and ATOM records:

>d1qfwm_ b.1.1.1 (M:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqspksmsmsvgervtlsckasetvdsfvswyqqkpeqspkllifgasnrfsgvpd
rftgsgsatdftltissvqaedfadyhcgqtynhpytfgggtkleikr

Timeline for d1qfwm_:

• d1qfwm_ first appeared (with stable ids) in SCOP 1.55
  
• d1qfwm_ appears in SCOP 1.69
  
• d1qfwm_ appears in SCOP 1.73
  
• d1qfwm_ appears in the current release, SCOPe 2.08