Lineage for d1qfwm_ (1qfw M:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219208Species Anti-[gonadotropin beta subunit] Fv, kappa L chain [48893] (1 PDB entry)
  8. 219210Domain d1qfwm_: 1qfw M: [20436]
    Other proteins in same PDB: d1qfwa_, d1qfwb_

Details for d1qfwm_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfwm_ b.1.1.1 (M:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin beta subunit] Fv, kappa L chain}
dieltqspksmsmsvgervtlsckasetvdsfvswyqqkpeqspkllifgasnrfsgvpd
rftgsgsatdftltissvqaedfadyhcgqtynhpytfgggtkleikr

SCOP Domain Coordinates for d1qfwm_:

Click to download the PDB-style file with coordinates for d1qfwm_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwm_: