Lineage for d1qfwh_ (1qfw H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287419Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)
  8. 287563Domain d1qfwh_: 1qfw H: [20435]
    Other proteins in same PDB: d1qfwa_, d1qfwb_, d1qfwl_, d1qfwm_
    part of anti-[gonadotropin alpha subunit] Fv
    complexed with nag

Details for d1qfwh_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwh_:

Sequence, based on SEQRES records: (download)

>d1qfwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
kfkskatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1qfwh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
kkatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss

SCOP Domain Coordinates for d1qfwh_:

Click to download the PDB-style file with coordinates for d1qfwh_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwh_: