Lineage for d1qfwh_ (1qfw H:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102183Species Anti-[gonadotropin alpha subunit] Fv, kappa L chain [48892] (1 PDB entry)
  8. 102184Domain d1qfwh_: 1qfw H: [20435]
    Other proteins in same PDB: d1qfwa_, d1qfwb_

Details for d1qfwh_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwh_:

Sequence, based on SEQRES records: (download)

>d1qfwh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin alpha subunit] Fv, kappa L chain}
qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
kfkskatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1qfwh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin alpha subunit] Fv, kappa L chain}
qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
kkatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss

SCOP Domain Coordinates for d1qfwh_:

Click to download the PDB-style file with coordinates for d1qfwh_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwh_: