Lineage for d1qfwl_ (1qfw L:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51840Species Anti-[gonadotropin alpha subunit] Fv, kappa L chain [48892] (1 PDB entry)
  8. 51842Domain d1qfwl_: 1qfw L: [20434]
    Other proteins in same PDB: d1qfwa_, d1qfwb_

Details for d1qfwl_

PDB Entry: 1qfw (more details), 3.5 Å

PDB Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit

SCOP Domain Sequences for d1qfwl_:

Sequence, based on SEQRES records: (download)

>d1qfwl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin alpha subunit] Fv, kappa L chain}
dieltqspdslavslgqratiscrasesvdsygnsfmqwyqqkpgqppklliyrasnles
giparfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr

Sequence, based on observed residues (ATOM records): (download)

>d1qfwl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-[gonadotropin alpha subunit] Fv, kappa L chain}
dieltqspdslavslgqratiscrasedsygnsfmqwyqqkpgqppklliyrasnlesgi
parfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr

SCOP Domain Coordinates for d1qfwl_:

Click to download the PDB-style file with coordinates for d1qfwl_.
(The format of our PDB-style files is described here.)

Timeline for d1qfwl_: