Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [225116] (2 PDB entries) |
Domain d2gdra2: 2gdr A:81-202 [204338] Other proteins in same PDB: d2gdra1, d2gdrb1, d2gdrc1, d2gdrd1, d2gdre1, d2gdrf1 automated match to d1n2aa1 complexed with gsh |
PDB Entry: 2gdr (more details), 2.1 Å
SCOPe Domain Sequences for d2gdra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdra2 a.45.1.0 (A:81-202) automated matches {Burkholderia xenovorans [TaxId: 266265]} qlapangsferyhlqqwlnfisselhksfsplfnpassdewknavrqslntrlgqvarql ehapyllgdqlsvadiylfvvlgwsayvnidlspwpslqafqgrvggreavqsalraegl ik
Timeline for d2gdra2: