SCOP 1.71: Domain d1cr9h1: 1cr9 H:1-110

Lineage for d1cr9h1 (1cr9 H:1-110)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (33 PDB entries)

8. Domain d1cr9h1: 1cr9 H:1-110 [20431]
   Other proteins in same PDB: d1cr9h2, d1cr9l1, d1cr9l2
   part of anti-prion Fab 3F4

Details for d1cr9h1

PDB Entry: 1cr9, 2 Å

PDB Description: crystal structure of the anti-prion fab 3f4

SCOP Domain Sequences for d1cr9h1:

Sequence; same for both SEQRES and ATOM records:

>d1cr9h1 b.1.1.1 (H:1-110) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
kvklqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnsey
aprfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvss

Timeline for d1cr9h1:

• d1cr9h1 first appeared (with stable ids) in SCOP 1.55
  
• d1cr9h1 appears in SCOP 1.69
  
• d1cr9h1 appears in SCOP 1.73
  
• d1cr9h1 appears in the current release, SCOPe 2.08