Lineage for d1ejoh1 (1ejo H:2501-2619)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157501Species Anti-FMDV Fab 4C4, (mouse), kappa L chain [48890] (1 PDB entry)
  8. 157502Domain d1ejoh1: 1ejo H:2501-2619 [20429]
    Other proteins in same PDB: d1ejoh2, d1ejol2

Details for d1ejoh1

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejoh1 b.1.1.1 (H:2501-2619) Immunoglobulin (variable domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
qmlvesggdlvkpggslklscaasgftfssytmswvrqtpekrlewvatissggaytyyp
dsvkgrftisddnaestlylqmsslrsedtamyycvrrafdsdvgfaswghrtlvtvsa

SCOP Domain Coordinates for d1ejoh1:

Click to download the PDB-style file with coordinates for d1ejoh1.
(The format of our PDB-style files is described here.)

Timeline for d1ejoh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejoh2