Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (20 species) not a true protein |
Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (8 PDB entries) |
Domain d2g3ia_: 2g3i A: [204289] automated match to d1e0xa_ complexed with po4; mutant |
PDB Entry: 2g3i (more details), 2.1 Å
SCOPe Domain Sequences for d2g3ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3ia_ c.1.8.3 (A:) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]} aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn fsagdrvynwavqngkqvrghtlawhsaqpgwmqslsgstlrqamidhingvmghykgki aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq gassstyaavtndclavsrclgitvwgvrdtdswasgdtpllfngdgskkaaytavlnal ngg
Timeline for d2g3ia_: