Lineage for d2g3ia_ (2g3i A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569823Protein automated matches [190057] (20 species)
    not a true protein
  7. 1569894Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (8 PDB entries)
  8. 1569905Domain d2g3ia_: 2g3i A: [204289]
    automated match to d1e0xa_
    complexed with po4; mutant

Details for d2g3ia_

PDB Entry: 2g3i (more details), 2.1 Å

PDB Description: Structure of S.olivaceoviridis xylanase Q88A/R275A mutant
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2g3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3ia_ c.1.8.3 (A:) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsaqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswasgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d2g3ia_:

Click to download the PDB-style file with coordinates for d2g3ia_.
(The format of our PDB-style files is described here.)

Timeline for d2g3ia_: