Lineage for d2g2ra1 (2g2r A:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520852Domain d2g2ra1: 2g2r A:1-107 [204285]
    Other proteins in same PDB: d2g2ra2, d2g2rl2
    automated match to d1dqdl1
    complexed with so4, tns

Details for d2g2ra1

PDB Entry: 2g2r (more details), 2.75 Å

PDB Description: Green-fluorescent antibody 11G10 in complex with its hapten (nitro-stilbene derivative)
PDB Compounds: (A:) Green-fluorescent antibody (11G10)-light chain

SCOPe Domain Sequences for d2g2ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2ra1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasiscrssqsllyingkthlnwllqrpgqspkrliylvskld
sgvpdrfsgsgsgtdftlkisrveaedlgiyfclqsthfpltfgagtklelk

SCOPe Domain Coordinates for d2g2ra1:

Click to download the PDB-style file with coordinates for d2g2ra1.
(The format of our PDB-style files is described here.)

Timeline for d2g2ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g2ra2