Lineage for d1ejol1 (1ejo L:2001-2111)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51747Species Anti-FMDV Fab 4C4, (mouse), kappa L chain [48890] (1 PDB entry)
  8. 51749Domain d1ejol1: 1ejo L:2001-2111 [20428]
    Other proteins in same PDB: d1ejoh2, d1ejol2

Details for d1ejol1

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.

SCOP Domain Sequences for d1ejol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejol1 b.1.1.1 (L:2001-2111) Immunoglobulin (variable domains of L and H chains) {Anti-FMDV Fab 4C4, (mouse), kappa L chain}
divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppklliyrasnles
giparfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtklelk

SCOP Domain Coordinates for d1ejol1:

Click to download the PDB-style file with coordinates for d1ejol1.
(The format of our PDB-style files is described here.)

Timeline for d1ejol1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejol2