Lineage for d1dqml1 (1dqm L:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157564Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries)
  8. 157572Domain d1dqml1: 1dqm L:1-107 [20426]
    Other proteins in same PDB: d1dqmh2, d1dqml2

Details for d1dqml1

PDB Entry: 1dqm (more details), 2.1 Å

PDB Description: crystal structure of anti-lysozyme antibody

SCOP Domain Sequences for d1dqml1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqml1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOP Domain Coordinates for d1dqml1:

Click to download the PDB-style file with coordinates for d1dqml1.
(The format of our PDB-style files is described here.)

Timeline for d1dqml1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqml2