Lineage for d2fnzb1 (2fnz B:17-164)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348919Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1348958Protein Lactate dehydrogenase [51859] (17 species)
  7. 1348983Species Cryptosporidium parvum [TaxId:5807] [225185] (4 PDB entries)
  8. 1348993Domain d2fnzb1: 2fnz B:17-164 [204250]
    Other proteins in same PDB: d2fnza2, d2fnzb2
    automated match to d1ez4a1
    complexed with gol, nad, oxm, so4

Details for d2fnzb1

PDB Entry: 2fnz (more details), 2.5 Å

PDB Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with cofactor (b-nicotinamide adenine dinucleotide) and inhibitor (oxamic acid)
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d2fnzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnzb1 c.2.1.5 (B:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma

SCOPe Domain Coordinates for d2fnzb1:

Click to download the PDB-style file with coordinates for d2fnzb1.
(The format of our PDB-style files is described here.)

Timeline for d2fnzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fnzb2