SCOPe 2.03: Domain d2fn7b1: 2fn7 B:17-164

Lineage for d2fn7b1 (2fn7 B:17-164)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Cryptosporidium parvum [TaxId:5807] [225185] (4 PDB entries)

8. Domain d2fn7b1: 2fn7 B:17-164 [204245]
   Other proteins in same PDB: d2fn7a2, d2fn7b2
   automated match to d1ez4a1
   complexed with gol, lac, nad

Details for d2fn7b1

PDB Entry: 2fn7, 2.3 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (lactic acid) and cofactor (b- nicotinamide adenine dinucleotide)

PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d2fn7b1:

Sequence; same for both SEQRES and ATOM records:

>d2fn7b1 c.2.1.5 (B:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma

Timeline for d2fn7b1:

• d2fn7b1 is new in SCOPe 2.03-stable
  
• d2fn7b1 appears in SCOPe 2.04
  
• d2fn7b1 appears in the current release, SCOPe 2.08