SCOPe 2.05: Domain d2fmyc2: 2fmy C:2139-2219

Lineage for d2fmyc2 (2fmy C:2139-2219)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Carboxydothermus hydrogenoformans [TaxId:129958] [225204] (1 PDB entry)

8. Domain d2fmyc2: 2fmy C:2139-2219 [204240]
   Other proteins in same PDB: d2fmya1, d2fmyb1, d2fmyc1, d2fmyd1
   automated match to d1ft9a1
   complexed with hem, imd

Details for d2fmyc2

PDB Entry: 2fmy, 2.2 Å

PDB Description: CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)

PDB Compounds: (C:) carbon monoxide oxidation system transcription regulator CooA-1

SCOPe Domain Sequences for d2fmyc2:

Sequence; same for both SEQRES and ATOM records:

>d2fmyc2 a.4.5.0 (C:2139-2219) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]}
darlrlaeflvqaamdtglkvpqgiklelglnteeialmlgttrqtvsvllndfkkmgil
ervnqrtlllkdlqklkefss

Timeline for d2fmyc2:

• d2fmyc2 first appeared in SCOPe 2.03
  
• d2fmyc2 appears in SCOPe 2.04
  
• d2fmyc2 appears in SCOPe 2.06
  
• d2fmyc2 appears in the current release, SCOPe 2.08