Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Carboxydothermus hydrogenoformans [TaxId:129958] [225204] (1 PDB entry) |
Domain d2fmyc2: 2fmy C:2139-2219 [204240] Other proteins in same PDB: d2fmya1, d2fmyb1, d2fmyc1, d2fmyd1 automated match to d1ft9a1 complexed with hem, imd |
PDB Entry: 2fmy (more details), 2.2 Å
SCOPe Domain Sequences for d2fmyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmyc2 a.4.5.0 (C:2139-2219) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]} darlrlaeflvqaamdtglkvpqgiklelglnteeialmlgttrqtvsvllndfkkmgil ervnqrtlllkdlqklkefss
Timeline for d2fmyc2: