SCOPe 2.03: Domain d2fmyc1: 2fmy C:2002-2138

Lineage for d2fmyc1 (2fmy C:2002-2138)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (8 species)
   not a true protein

7. Species Carboxydothermus hydrogenoformans [TaxId:129958] [225203] (1 PDB entry)

8. Domain d2fmyc1: 2fmy C:2002-2138 [204239]
   Other proteins in same PDB: d2fmya2, d2fmyb2, d2fmyc2, d2fmyd2
   automated match to d1ft9a2
   complexed with hem, imd

Details for d2fmyc1

PDB Entry: 2fmy, 2.2 Å

PDB Description: CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)

PDB Compounds: (C:) carbon monoxide oxidation system transcription regulator CooA-1

SCOPe Domain Sequences for d2fmyc1:

Sequence; same for both SEQRES and ATOM records:

>d2fmyc1 b.82.3.0 (C:2002-2138) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]}
atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
gdllknsltiinglvfk

Timeline for d2fmyc1:

• d2fmyc1 is new in SCOPe 2.03-stable
  
• d2fmyc1 appears in SCOPe 2.04
  
• d2fmyc1 appears in the current release, SCOPe 2.08