Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (8 species) not a true protein |
Species Carboxydothermus hydrogenoformans [TaxId:129958] [225203] (1 PDB entry) |
Domain d2fmyc1: 2fmy C:2002-2138 [204239] Other proteins in same PDB: d2fmya2, d2fmyb2, d2fmyc2, d2fmyd2 automated match to d1ft9a2 complexed with hem, imd |
PDB Entry: 2fmy (more details), 2.2 Å
SCOPe Domain Sequences for d2fmyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmyc1 b.82.3.0 (C:2002-2138) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]} atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl gdllknsltiinglvfk
Timeline for d2fmyc1: