![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (41 species) not a true protein |
![]() | Species Carboxydothermus hydrogenoformans [TaxId:129958] [225204] (1 PDB entry) |
![]() | Domain d2fmyb2: 2fmy B:1139-1219 [204238] Other proteins in same PDB: d2fmya1, d2fmyb1, d2fmyc1, d2fmyd1 automated match to d1ft9a1 complexed with hem, imd |
PDB Entry: 2fmy (more details), 2.2 Å
SCOPe Domain Sequences for d2fmyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmyb2 a.4.5.0 (B:1139-1219) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]} darlrlaeflvqaamdtglkvpqgiklelglnteeialmlgttrqtvsvllndfkkmgil ervnqrtlllkdlqklkefss
Timeline for d2fmyb2: