Lineage for d1dqqd1 (1dqq D:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511324Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 1511336Domain d1dqqd1: 1dqq D:1-113 [20423]
    Other proteins in same PDB: d1dqqa1, d1dqqa2, d1dqqb2, d1dqqc1, d1dqqc2, d1dqqd2
    part of anti-lysozyme Fab HYHEL-63

Details for d1dqqd1

PDB Entry: 1dqq (more details), 1.8 Å

PDB Description: crystal structure of anti-lysozyme antibody hyhel-63
PDB Compounds: (D:) anti-lysozyme antibody hyhel-63 (heavy chain)

SCOPe Domain Sequences for d1dqqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqqd1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

SCOPe Domain Coordinates for d1dqqd1:

Click to download the PDB-style file with coordinates for d1dqqd1.
(The format of our PDB-style files is described here.)

Timeline for d1dqqd1: