SCOP 1.63: Domain d1dqqd1: 1dqq D:1-113

Lineage for d1dqqd1 (1dqq D:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries)

8. Domain d1dqqd1: 1dqq D:1-113 [20423]
   Other proteins in same PDB: d1dqqa2, d1dqqb2, d1dqqc2, d1dqqd2

Details for d1dqqd1

PDB Entry: 1dqq, 1.8 Å

PDB Description: crystal structure of anti-lysozyme antibody hyhel-63

SCOP Domain Sequences for d1dqqd1:

Sequence; same for both SEQRES and ATOM records:

>d1dqqd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

Timeline for d1dqqd1:

• d1dqqd1 first appeared (with stable ids) in SCOP 1.55
  
• d1dqqd1 appears in SCOP 1.61
  
• d1dqqd1 appears in SCOP 1.65
  
• d1dqqd1 appears in the current release, SCOPe 2.08