Lineage for d1dqqd1 (1dqq D:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102122Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries)
  8. 102126Domain d1dqqd1: 1dqq D:1-113 [20423]
    Other proteins in same PDB: d1dqqa2, d1dqqb2, d1dqqc2, d1dqqd2

Details for d1dqqd1

PDB Entry: 1dqq (more details), 1.8 Å

PDB Description: crystal structure of anti-lysozyme antibody hyhel-63

SCOP Domain Sequences for d1dqqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqqd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

SCOP Domain Coordinates for d1dqqd1:

Click to download the PDB-style file with coordinates for d1dqqd1.
(The format of our PDB-style files is described here.)

Timeline for d1dqqd1: