![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [48889] (3 PDB entries) |
![]() | Domain d1dqqd1: 1dqq D:1-113 [20423] Other proteins in same PDB: d1dqqa2, d1dqqb2, d1dqqc2, d1dqqd2 |
PDB Entry: 1dqq (more details), 1.8 Å
SCOP Domain Sequences for d1dqqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqqd1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain} evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss
Timeline for d1dqqd1: