Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Cryptosporidium parvum [TaxId:5807] [225104] (2 PDB entries) |
Domain d2fm3b1: 2fm3 B:17-164 [204227] Other proteins in same PDB: d2fm3a2, d2fm3b2 automated match to d1ez4a1 complexed with gol, nad, pyr |
PDB Entry: 2fm3 (more details), 2.2 Å
SCOPe Domain Sequences for d2fm3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fm3b1 c.2.1.0 (B:17-164) automated matches {Cryptosporidium parvum [TaxId: 5807]} mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici tnpldvmvshfqkvsglphnkvcgma
Timeline for d2fm3b1: