| Class b: All beta proteins [48724] (178 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Pullulanase PulA [159262] (1 species) |
| Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries) Uniprot P07206 973-1090 |
| Domain d2fh8a4: 2fh8 A:966-1083 [204219] Other proteins in same PDB: d2fh8a1, d2fh8a2, d2fh8a3 automated match to d2fhfa4 complexed with bgc, ca, glc |
PDB Entry: 2fh8 (more details), 1.9 Å
SCOPe Domain Sequences for d2fh8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh8a4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk
Timeline for d2fh8a4: