SCOPe 2.06: Domain d2fh8a4: 2fh8 A:966-1083

Lineage for d2fh8a4 (2fh8 A:966-1083)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Pullulanase PulA [159262] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries)
   Uniprot P07206 973-1090

8. Domain d2fh8a4: 2fh8 A:966-1083 [204219]
   Other proteins in same PDB: d2fh8a1, d2fh8a2, d2fh8a3
   automated match to d2fhfa4
   complexed with ca

Details for d2fh8a4

PDB Entry: 2fh8, 1.9 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with isomaltose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh8a4:

Sequence; same for both SEQRES and ATOM records:

>d2fh8a4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

Timeline for d2fh8a4:

• d2fh8a4 first appeared in SCOPe 2.03
  
• d2fh8a4 appears in SCOPe 2.05
  
• d2fh8a4 appears in SCOPe 2.07
  
• d2fh8a4 appears in the current release, SCOPe 2.08