Lineage for d2fh8a2 (2fh8 A:288-402)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299506Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1299735Protein Pullulanase PulA [158883] (1 species)
    contains two E-set domains in tandem
  7. 1299736Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
    Uniprot P07206 170-294! Uniprot P07206 295-409
  8. 1299748Domain d2fh8a2: 2fh8 A:288-402 [204217]
    Other proteins in same PDB: d2fh8a3, d2fh8a4
    automated match to d2fhfa1
    complexed with ca

Details for d2fh8a2

PDB Entry: 2fh8 (more details), 1.9 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with isomaltose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh8a2 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

SCOPe Domain Coordinates for d2fh8a2:

Click to download the PDB-style file with coordinates for d2fh8a2.
(The format of our PDB-style files is described here.)

Timeline for d2fh8a2: