SCOPe 2.05: Domain d2fh6a4: 2fh6 A:966-1083

Lineage for d2fh6a4 (2fh6 A:966-1083)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Pullulanase PulA [159262] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries)
   Uniprot P07206 973-1090

8. Domain d2fh6a4: 2fh6 A:966-1083 [204215]
   Other proteins in same PDB: d2fh6a1, d2fh6a2, d2fh6a3
   automated match to d2fhfa4
   complexed with ca, glc

Details for d2fh6a4

PDB Entry: 2fh6, 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh6a4:

Sequence; same for both SEQRES and ATOM records:

>d2fh6a4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

Timeline for d2fh6a4:

• d2fh6a4 first appeared in SCOPe 2.03
  
• d2fh6a4 appears in SCOPe 2.04
  
• d2fh6a4 appears in SCOPe 2.06
  
• d2fh6a4 appears in the current release, SCOPe 2.08