Lineage for d2fh6a4 (2fh6 A:966-1083)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804444Protein Pullulanase PulA [159262] (1 species)
  7. 1804445Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries)
    Uniprot P07206 973-1090
  8. 1804449Domain d2fh6a4: 2fh6 A:966-1083 [204215]
    Other proteins in same PDB: d2fh6a1, d2fh6a2, d2fh6a3
    automated match to d2fhfa4
    complexed with ca, glc

Details for d2fh6a4

PDB Entry: 2fh6 (more details), 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fh6a4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

SCOPe Domain Coordinates for d2fh6a4:

Click to download the PDB-style file with coordinates for d2fh6a4.
(The format of our PDB-style files is described here.)

Timeline for d2fh6a4: