SCOPe 2.05: Domain d2fh6a2: 2fh6 A:288-402

Lineage for d2fh6a2 (2fh6 A:288-402)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Pullulanase PulA [158883] (1 species)
   contains two E-set domains in tandem

7. Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
   Uniprot P07206 170-294! Uniprot P07206 295-409

8. Domain d2fh6a2: 2fh6 A:288-402 [204213]
   Other proteins in same PDB: d2fh6a3, d2fh6a4
   automated match to d2fhfa1
   complexed with ca, glc

Details for d2fh6a2

PDB Entry: 2fh6, 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with glucose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fh6a2:

Sequence; same for both SEQRES and ATOM records:

>d2fh6a2 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

Timeline for d2fh6a2:

• d2fh6a2 first appeared in SCOPe 2.03
  
• d2fh6a2 appears in SCOPe 2.04
  
• d2fh6a2 appears in SCOPe 2.06
  
• d2fh6a2 appears in the current release, SCOPe 2.08