Lineage for d1dqqb1 (1dqq B:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652917Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (22 PDB entries)
  8. 652923Domain d1dqqb1: 1dqq B:1-113 [20421]
    Other proteins in same PDB: d1dqqa1, d1dqqa2, d1dqqb2, d1dqqc1, d1dqqc2, d1dqqd2

Details for d1dqqb1

PDB Entry: 1dqq (more details), 1.8 Å

PDB Description: crystal structure of anti-lysozyme antibody hyhel-63
PDB Compounds: (B:) anti-lysozyme antibody hyhel-63 (heavy chain)

SCOP Domain Sequences for d1dqqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqqb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

SCOP Domain Coordinates for d1dqqb1:

Click to download the PDB-style file with coordinates for d1dqqb1.
(The format of our PDB-style files is described here.)

Timeline for d1dqqb1: