Lineage for d2fgza1 (2fgz A:166-287)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299506Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1299735Protein Pullulanase PulA [158883] (1 species)
    contains two E-set domains in tandem
  7. 1299736Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
    Uniprot P07206 170-294! Uniprot P07206 295-409
  8. 1299739Domain d2fgza1: 2fgz A:166-287 [204208]
    Other proteins in same PDB: d2fgza3, d2fgza4
    automated match to d2fhfa2
    complexed with ca

Details for d2fgza1

PDB Entry: 2fgz (more details), 1.75 Å

PDB Description: crystal structure analysis of apo pullulanase from klebsiella pneumoniae
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgza1 b.1.18.2 (A:166-287) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvkltp
ttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtagvld
dt

SCOPe Domain Coordinates for d2fgza1:

Click to download the PDB-style file with coordinates for d2fgza1.
(The format of our PDB-style files is described here.)

Timeline for d2fgza1: