| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Pullulanase PulA [158883] (1 species) contains two E-set domains in tandem |
| Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries) Uniprot P07206 170-294! Uniprot P07206 295-409 |
| Domain d2fgza1: 2fgz A:166-287 [204208] Other proteins in same PDB: d2fgza3, d2fgza4 automated match to d2fhfa2 complexed with ca |
PDB Entry: 2fgz (more details), 1.75 Å
SCOPe Domain Sequences for d2fgza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgza1 b.1.18.2 (A:166-287) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvkltp
ttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtagvld
dt
Timeline for d2fgza1: