Lineage for d2fe3b_ (2fe3 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1479958Species Bacillus subtilis [TaxId:1423] [187193] (6 PDB entries)
  8. 1479960Domain d2fe3b_: 2fe3 B: [204207]
    automated match to d2o03a_
    complexed with zn

Details for d2fe3b_

PDB Entry: 2fe3 (more details), 1.75 Å

PDB Description: The crystal structure of bacillus subtilis PerR-Zn reveals a novel Zn(Cys)4 Structural redox switch
PDB Compounds: (B:) Peroxide operon regulator

SCOPe Domain Sequences for d2fe3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe3b_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynn
lrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtg
fkvshhrleiygvcqecskkenh

SCOPe Domain Coordinates for d2fe3b_:

Click to download the PDB-style file with coordinates for d2fe3b_.
(The format of our PDB-style files is described here.)

Timeline for d2fe3b_: