SCOPe 2.08: Domain d2fe3a_: 2fe3 A:

Lineage for d2fe3a_ (2fe3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries)

8. Domain d2fe3a_: 2fe3 A: [204206]
   automated match to d2o03a_
   complexed with zn

Details for d2fe3a_

PDB Entry: 2fe3, 1.75 Å

PDB Description: The crystal structure of bacillus subtilis PerR-Zn reveals a novel Zn(Cys)4 Structural redox switch

PDB Compounds: (A:) Peroxide operon regulator

SCOPe Domain Sequences for d2fe3a_:

Sequence; same for both SEQRES and ATOM records:

>d2fe3a_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
kvshhrleiygvcqecskken

Timeline for d2fe3a_:

• d2fe3a_ first appeared in SCOPe 2.03
  
• d2fe3a_ appears in SCOPe 2.07