Lineage for d1cl7l1 (1cl7 L:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7335Species Fab 1696, (mouse), kappa L chain [48888] (1 PDB entry)
  8. 7337Domain d1cl7l1: 1cl7 L:1-107 [20418]
    Other proteins in same PDB: d1cl7.1, d1cl7l2

Details for d1cl7l1

PDB Entry: 1cl7 (more details), 3 Å

PDB Description: anti hiv1 protease fab

SCOP Domain Sequences for d1cl7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl7l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 1696, (mouse), kappa L chain}
dvlmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleik

SCOP Domain Coordinates for d1cl7l1:

Click to download the PDB-style file with coordinates for d1cl7l1.
(The format of our PDB-style files is described here.)

Timeline for d1cl7l1: