SCOPe 2.08: Domain d2fafb1: 2faf B:34-278

Lineage for d2fafb1 (2faf B:34-278)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225083] (4 PDB entries)

8. Domain d2fafb1: 2faf B:34-278 [204178]
   Other proteins in same PDB: d2fafa2, d2fafb2
   automated match to d1khba2
   complexed with 1pe, epe, mn

Details for d2fafb1

PDB Entry: 2faf, 1.7 Å

PDB Description: the structure of chicken mitochondrial pepck.

PDB Compounds: (B:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2fafb1:

Sequence; same for both SEQRES and ATOM records:

>d2fafb1 c.109.1.0 (B:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
aqqqg

Timeline for d2fafb1:

• d2fafb1 first appeared in SCOPe 2.03
  
• d2fafb1 appears in SCOPe 2.07