SCOPe 2.08: Domain d2f42a1: 2f42 A:127-204

Lineage for d2f42a1 (2f42 A:127-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [225069] (1 PDB entry)

8. Domain d2f42a1: 2f42 A:127-204 [204171]
   Other proteins in same PDB: d2f42a2
   automated match to d2c2la1
   complexed with cl

Details for d2f42a1

PDB Entry: 2f42, 2.5 Å

PDB Description: dimerization and U-box domains of Zebrafish C-terminal of HSP70 interacting protein

PDB Compounds: (A:) STIP1 homology and U-Box containing protein 1

SCOPe Domain Sequences for d2f42a1:

Sequence, based on SEQRES records:

>d2f42a1 a.118.8.0 (A:127-204) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
akkkrwnsieekrisqenelhaylsklilaekerelddrvkqsddsqnggdiskmkskhd
kylmdmdelfsqvdekrk

Sequence, based on observed residues (ATOM records):

>d2f42a1 a.118.8.0 (A:127-204) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
akkkrwnsieekrisqenelhaylsklilaekerelddskhdkylmdmdelfsqvdekrk

Timeline for d2f42a1:

• d2f42a1 first appeared in SCOPe 2.03
  
• d2f42a1 appears in SCOPe 2.07